Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | Caspase-1 Rabbit mAb |
---|---|
Catalog No. | A23429 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC60705 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Caspase-1 p20(NP_001244047.1). |
---|---|
Sequence | DVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVG |
Gene ID | |
Swiss Prot | |
Synonyms | ICE; P45; IL1BC; Caspase-1 p20 |
Calculated MW | 10KDa/29KDa/35KDa/42KDa/45KDa |
Observed MW | 20-25kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | THP-1 treated by TPA and LPS |
Cellular location | Cytoplasm, Cell membrane . |
Customer validation | WB(Homo sapiens, Mus musculus, Rattus norvegicus) IF(Homo sapiens) IF(Homo sapiens) WB(Homo sapiens) Other(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A23429? Please let us know so that we can cite the reference in this datasheet.