Reviews (2)Publications (50) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Caspase-8 Rabbit pAb |
---|---|
Catalog No. | A0215 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 376-479 of human Caspase 8 (NP_203519.1). |
---|---|
Sequence | EEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD |
Gene ID | |
Swiss Prot | |
Synonyms | CAP4; MACH; MCH5; FLICE; ALPS2B; Casp-8; Caspase-8 |
Calculated MW | 55kDa |
Observed MW | 57kDa/ |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | C2C12, Jurkat, |
Cellular location | Cytoplasm. |
Customer validation | (Eoma cell, N9) WB(Mus musculus, Bos taurus, Homo sapiens, Rattus norvegicus, Ctenopharyngodon idellus, Sus scrofa, Gallus gallus, Mus musculus, ) IHC(Rattus norvegicus) IHC(Mus musculus) RT-PCR(Ctenopharyngodon idellus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A0215? Please let us know so that we can cite the reference in this datasheet.