제품 > 항체 > 단일클론항체(mAb)

Cathepsin L/V/K/H Rabbit mAb (A4986)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Cathepsin L/V/K/H Rabbit mAb (A4986) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - Cathepsin L/V/K/H Rabbit mAb (A4986)

Immunohistochemistry analysis of Cathepsin L/V/K/H in paraffin-embedded rat brain tissue using Cathepsin L/V/K/H Rabbit mAb (A4986) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Cathepsin L/V/K/H in paraffin-embedded mouse kidney tissue using Cathepsin L/V/K/H Rabbit mAb (A4986) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Cathepsin L/V/K/H in paraffin-embedded human liver cancer tissue using Cathepsin L/V/K/H Rabbit mAb (A4986) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Cathepsin L/V/K/H in paraffin-embedded human liver tissue using Cathepsin L/V/K/H Rabbit mAb (A4986) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	Cathepsin L/V/K/H Rabbit mAb
Catalog No.	A4986
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1276

Background

The protein encoded by this gene is a lysosomal cysteine proteinase that plays a major role in intracellular protein catabolism. Its substrates include collagen and elastin, as well as alpha-1 protease inhibitor, a major controlling element of neutrophil elastase activity. The encoded protein has been implicated in several pathologic processes, including myofibril necrosis in myopathies and in myocardial ischemia, and in the renal tubular response to proteinuria. This protein, which is a member of the peptidase C1 family, is a dimer composed of disulfide-linked heavy and light chains, both produced from a single protein precursor. Additionally, this protein cleaves the S1 subunit of the SARS-CoV-2 spike protein, which is necessary for entry of the virus into the cell.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Cathepsin L/V/K/H (P07711).
Sequence	AVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRKPRKGKVFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQ
Gene ID
Swiss Prot
Synonyms	MEP; CATL; CTSL1; Cathepsin L/V/K/H
Calculated MW	38kDa
Observed MW	38kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse liver, Rat liver
Cellular location	Lysosome, Apical cell membrane, Cytoplasmic vesicle, secretory vesicle, chromaffin granule, Secreted, extracellular space, Secreted
Customer validation	WB(Mus musculus, Homo sapiens)