제품 > 항체 > 단일클론항체(mAb)

ChAT Rabbit mAb (A19031)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse，Rat

Western blot analysis of lysates from SH-SY5Y cells, using CHAT Rabbit mAb (A19031) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunofluorescence - ChAT Rabbit mAb (A19031)

Confocal imaging of paraffin-embedded mouse brain using CHAT Rabbit mAb (A19031, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.

Confocal imaging of paraffin-embedded rat brain using CHAT Rabbit mAb (A19031, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.

Overview

Product name	ChAT Rabbit mAb
Catalog No.	A19031
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0491

Background

This gene encodes an enzyme which catalyzes the biosynthesis of the neurotransmitter acetylcholine. This gene product is a characteristic feature of cholinergic neurons, and changes in these neurons may explain some of the symptoms of Alzheimer's disease. Polymorphisms in this gene have been associated with Alzheimer's disease and mild cognitive impairment. Mutations in this gene are associated with congenital myasthenic syndrome associated with episodic apnea. Multiple transcript variants encoding different isoforms have been found for this gene, and some of these variants have been shown to encode more than one isoform.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 649-748 of human CHAT (P28329).
Sequence	MSNRFVLSTSQVPTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATRPSQGHQP
Gene ID
Swiss Prot
Synonyms	CMS6; CMS1A; CMS1A2; CHOACTASE; CHAT
Calculated MW	83kDa
Observed MW	65kDa

Applications

Reactivity	Human, Mouse，Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IF/ICC 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	SH-SY5Y
Cellular location	cytoplasm, cytosol, neuron projection, nucleus, synapse.
Customer validation	IF(Mus musculus) WB(Mus musculus)