Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | Cleaved Caspase-3 (Asp175) Rabbit mAb |
---|---|
Catalog No. | A27145 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC63429 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 76-175 of human Caspase-3 (NP_004337.2). |
---|---|
Sequence | ETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD |
Gene ID | |
Swiss Prot | |
Synonyms | CPP32; SCA-1; CPP32B |
Calculated MW | 32kDa |
Observed MW | 17kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa |
Cellular location | Cytoplasm, cytoplasm, cytosol, nucleoplasm, nucleus. |
Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A27145? Please let us know so that we can cite the reference in this datasheet.