제품 > 항체 > 단일클론항체(mAb)

Cleaved Caspase-3 (Asp175) Rabbit mAb (A27145)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from HeLa cells using Cleaved Caspase-3 (Asp175) Rabbit mAb (A27145) at 1:1000 dilution incubated overnight at 4℃. HeLa cells were treated by staurosporine (1μM) for 3 hour.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 30 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	Cleaved Caspase-3 (Asp175) Rabbit mAb
Catalog No.	A27145
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63429

Background

The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 76-175 of human Caspase-3 (NP_004337.2).
Sequence	ETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
Gene ID
Swiss Prot
Synonyms	CPP32; SCA-1; CPP32B
Calculated MW	32kDa
Observed MW	17kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa
Cellular location	Cytoplasm, cytoplasm, cytosol, nucleoplasm, nucleus.
Customer validation	WB(Homo sapiens)