Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | Cleaved PARP1 p25 Rabbit mAb |
---|---|
Catalog No. | A19612 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0091 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-214 of human Cleaved PARP1 p25 (P09874). |
---|---|
Sequence | QLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVD |
Gene ID | |
Swiss Prot | |
Synonyms | PARP; PARS; PPOL; ADPRT; ARTD1; ADPRT1; PARP-1; ADPRT 1; pADPRT-1; Poly-PARP; Cleaved PARP1 p25 |
Calculated MW | 113kDa |
Observed MW | 27kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunoprecipitation |
Positive samples | Jurkat treated by Staurosporine, Mouse spleen, NIH/3T3 |
Cellular location | Nucleus, nucleolus |
Customer validation | WB(Homo sapiens, Mus musculus, Mus musculus, ) IHC(Homo sapiens) IF(Mus musculus) IHC(Homo sapiens, Mus musculus,) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19612? Please let us know so that we can cite the reference in this datasheet.