제품 > 항체 > 단일클론항체(mAb)

Cytochrome P450 2E1 (CYP2E1) Rabbit mAb (A22629)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using Cytochrome P450 2E1 (CYP2E1) Rabbit mAb (A22629) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - Cytochrome P450 2E1 (CYP2E1) Rabbit mAb (A22629)

Immunohistochemistry analysis of Cytochrome P450 2E1 (CYP2E1) in paraffin-embedded human liver tissue using Cytochrome P450 2E1 (CYP2E1) Rabbit mAb (A22629) at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Cytochrome P450 2E1 (CYP2E1) in paraffin-embedded rat liver tissue using Cytochrome P450 2E1 (CYP2E1) Rabbit mAb (A22629) at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Cytochrome P450 2E1 (CYP2E1) in paraffin-embedded mouse liver tissue using Cytochrome P450 2E1 (CYP2E1) Rabbit mAb (A22629) at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	Cytochrome P450 2E1 (CYP2E1) Rabbit mAb
Catalog No.	A22629
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC58003

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 234-493 of human CYP2E1 (NP_000764.1)
Sequence	KVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVIPRS
Gene ID
Swiss Prot
Synonyms	CPE1; CYP2E; P450-J; P450C2E; Cytochrome P450 2E1 (CYP2E1)
Calculated MW	57kDa
Observed MW

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:10000 IHC-P 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse liver, Rat liver
Cellular location	Endoplasmic reticulum membrane, Microsome membrane, Peripheral membrane protein
Customer validation	WB(Rattus norvegicus) IHC(Rattus norvegicus)