제품 > 항체 > 단일클론항체(mAb)

Cytokeratin 19 (KRT19) Rabbit PolymAb® (A0247PM)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Hep G2 cells using Cytokeratin 19 (KRT19) Rabbit PolymAb® (A0247PM) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of lysates from Rat lung using Cytokeratin 19 (KRT19) Rabbit PolymAb® (A0247PM) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from Mouse lung using Cytokeratin 19 (KRT19) Rabbit PolymAb® (A0247PM) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Cytokeratin 19 (KRT19) Rabbit PolymAb® (A0247PM)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Cytokeratin 19 (KRT19) Rabbit PolymAb® (A0247PM) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using Cytokeratin 19 (KRT19) Rabbit PolymAb® (A0247PM) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human hepatocholangiocarcinoma tissue using Cytokeratin 19 (KRT19) Rabbit PolymAb® (A0247PM) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Cytokeratin 19 (KRT19) Rabbit PolymAb® (A0247PM) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Cytokeratin 19 (KRT19) Rabbit PolymAb® (A0247PM) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Overview

Product name	Cytokeratin 19 (KRT19) Rabbit PolymAb®
Catalog No.	A0247PM
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 243-400 of human Cytokeratin 19 (KRT19) (NP_002267.2).
Sequence	TDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
Gene ID
Swiss Prot
Synonyms	K19; CK19; K1CS
Calculated MW	44kDa
Observed MW	44kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:10000 IHC-P 1:4000 - 1:20000 ELISA Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Rat lung, Mouse lung, Hep G2
Cellular location	Cytoplasm, apicolateral plasma membrane, costamere, cytoskeleton, cytosol, extracellular exosome, plasma membrane, sarcolemma, terminal web, Z disc.