제품 > 항체 > 단일클론항체(mAb)

Cytokeratin 4 (KRT4) Rabbit mAb (A0013)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Cytokeratin 4 (KRT4) (KRT4) Rabbit mAb (A0013) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - Cytokeratin 4 (KRT4) Rabbit mAb (A0013)

Immunohistochemistry analysis of paraffin-embedded human esophagus tissue using Cytokeratin 4 (KRT4) Rabbit mAb (A0013) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded human tonsil tissue using Cytokeratin 4 (KRT4) Rabbit mAb (A0013) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded human breast tissue using Cytokeratin 4 (KRT4) Rabbit mAb (A0013) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - Cytokeratin 4 (KRT4) Rabbit mAb (A0013)

Confocal imaging of human tonsil tissue using Cytokeratin 4 (KRT4) Rabbit mAb (A0013, dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 40x.Perform high pressure antigen retrieval with 10 mM citrate buffer (pH 6.0) before commencing with IF staining protocol.

Overview

Product name	Cytokeratin 4 (KRT4) Rabbit mAb
Catalog No.	A0013
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1804

Background

The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in differentiated layers of the mucosal and esophageal epithelia with family member KRT13. Mutations in these genes have been associated with White Sponge Nevus, characterized by oral, esophageal, and anal leukoplakia. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 4 (KRT4) (P19013).
Sequence	MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGAGRCSSGGFGSRSLYNLRGNKSISMSVAGSRQGACFGGAGGFGTGGFGGGFGGSFSGKGGPG
Gene ID
Swiss Prot
Synonyms	K4; CK4; CK-4; CYK4; WSN1; Cytokeratin 4 (KRT4)
Calculated MW	56kDa
Observed MW	57kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:4000 IHC-P 1:500 - 1:2000 IF/ICC 1:100 - 1:400 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	A549, A-431, Mouse stomach
Cellular location	cell surface, cytosol, intermediate filament cytoskeleton, nucleus.