Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | DDX4 Rabbit pAb |
---|---|
Catalog No. | A15624 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 635-724 of human DDX4 (NP_077726.1). |
---|---|
Sequence | GNTGRAISFFDLESDNHLAQPLVKVLTDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKGKSTLNTAGFSSSQAPNPVDDESWD |
Gene ID | |
Swiss Prot | |
Synonyms | VASA; DDX4 |
Calculated MW | 79kDa |
Observed MW | 79kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Mouse testis |
Cellular location | Cytoplasm, perinuclear region. |
Customer validation | IHC(Oncorhynchus mykiss, Homo sapiens) WB(Nile tilapia, Mus musculus) IF(Mus musculus) Other(Capra hircus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A15624? Please let us know so that we can cite the reference in this datasheet.