제품 > 항체 > 다중클론항체(pAb)

DEP1 Rabbit pAb (A19181)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Oryza sativa

Western blot analysis of extracts of various tissues from the japonica rice (Oryza sativa L.) variety Zhonghua 11, using DEP1 Rabbit pAb (A19181) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

Overview

Product name	DEP1 Rabbit pAb
Catalog No.	A19181
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Guanine nucleotide-binding proteins (G proteins are involved as a modulator or transducer in various transmembrane signaling systems (Probable. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction (Probable. Involved in the regulation of plant architecture, panicle erectness, panicle and grain length, grain weight, and grain yield. Involved in the regulation of grain size.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of Oryza sativa DEP1. (Q67UU9).
Sequence	MGEEAVVMEAPRPKSPPRYPDLCGRRRMQLEVQILSREITFLKDELHFLEGAQPVSRSGCIKEINEFVGTKHDPLIPTKRRRHRSCRLFRWIGSKLCICI
Gene ID
Swiss Prot
Synonyms	DN1; DEP1; pay1
Calculated MW	45kDa
Observed MW	50kDa/60kDa

Applications

Reactivity	Oryza sativa
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	stems (before flower), leaves sheath (before flower), flower buds (before flower), flag leaves (after flower), flowers, milk seeds
Cellular location	nucleus, plasma membrane