Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | DNA topoisomerase II alpha (TOP2A) Rabbit pAb |
---|---|
Catalog No. | A16440 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human DNA topoisomerase II alpha (TOP2A) (NP_001058.2). |
---|---|
Sequence | EEENEESDNEKETEKSDSVTDSGPTFNYLLDMPLWYLTKEKKDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQVGLPGKGGKA |
Gene ID | |
Swiss Prot | |
Synonyms | TOP2; TP2A; TOPIIA; TOP2alpha; DNA topoisomerase II alpha (TOP2A) |
Calculated MW | 174kDa |
Observed MW | 190kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, 293T |
Cellular location | Cytoplasm, Nucleus, nucleoplasm. |
Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16440? Please let us know so that we can cite the reference in this datasheet.