제품 > 항체 > 다중클론항체(pAb)

DNA topoisomerase I (TOP1) Rabbit pAb (A12524)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using DNA topoisomerase I (TOP1) Rabbit pAb (A12524) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - DNA topoisomerase I (TOP1) Rabbit pAb (A12524)

Immunohistochemistry analysis of paraffin-embedded mouse liver using DNA topoisomerase I (TOP1) Rabbit pAb (A12524) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - DNA topoisomerase I (TOP1) Rabbit pAb (A12524)

Immunoprecipitation analysis of 200 μg extracts of Jurkat cells, using 3 μg DNA topoisomerase I (DNA topoisomerase I (TOP1)) antibody (A12524). Western blot was performed from the immunoprecipitate using DNA topoisomerase I (DNA topoisomerase I (TOP1)) antibody (A12524) at a dilution of 1:1000.

Overview

Product name	DNA topoisomerase I (TOP1) Rabbit pAb
Catalog No.	A12524
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus altering the topology of DNA. This gene is localized to chromosome 20 and has pseudogenes which reside on chromosomes 1 and 22.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNA topoisomerase I (DNA topoisomerase I (TOP1)) (NP_003277.1).
Sequence	MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDA
Gene ID
Swiss Prot
Synonyms	TOPI; DNA topoisomerase I (TOP1)
Calculated MW	91kDa
Observed MW	120kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	MCF7, SKOV3, SW480, Jurkat, HeLa, Mouse spleen, Mouse ovary
Cellular location	Nucleus, nucleolus, nucleoplasm