Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using EPAS1/HIF2α Rabbit pAb (A7553) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using EPAS1/HIF2α Rabbit pAb (A7553) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human brain using EPAS1/HIF2α Rabbit pAb (A7553) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
| Product name | EPAS1/HIF2α Rabbit pAb |
|---|---|
| Catalog No. | A7553 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 678-745 of human EPAS1/HIF2α (NP_001421.2). |
|---|---|
| Sequence | TFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTSHLMWKRMKNLRG |
| Gene ID | |
| Swiss Prot | |
| Synonyms | HLF; MOP2; ECYT4; HIF2A; PASD2; bHLHe73; EPAS1/HIF2α |
| Calculated MW | 96kDa |
| Observed MW | 120kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | HepG2, NIH/3T3 |
| Cellular location | Nucleus, Nucleus speckle. |
| Customer validation | IF(Mus musculus) WB(Rattus norvegicus, Homo sapiens, Mus musculus, Mus musculus, Danio rerio, Rattus norvegicus ) ChIP(Homo sapiens) IHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A7553? Please let us know so that we can cite the reference in this datasheet.
