Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using EpCAM Rabbit mAb (A19301) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Confocal imaging of Human colon using EpCAM Rabbit mAb (A19301, dilution 1:50)(Red). DAPI was used for nuclear staining (blue). Objective: 40x.
| Product name | EpCAM Rabbit mAb |
|---|---|
| Catalog No. | A19301 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC0277 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 215-314 of human EpCAM (P16422). |
|---|---|
| Sequence | YFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA |
| Gene ID | |
| Swiss Prot | |
| Synonyms | ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; BerEp4; EGP314; HNPCC8; LYNCH8; MOC-31; Ber-Ep4; TACSTD1; EpCAM |
| Calculated MW | 35kDa |
| Observed MW | Refer to figures |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | |
| Cellular location | Cell junction, Lateral cell membrane, Single-pass type I membrane protein, tight junction. |
| Customer validation | IF(Homo sapiens, Mus musculus) WB(Mus musculus, Homo sapiens) IF(Homo sapiens) IHC(Mus musculus) IHC(Homo sapiens,Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19301? Please let us know so that we can cite the reference in this datasheet.
Y_IF_01.jpg?t=1721357170)
