제품 > 항체 > 단일클론항체(mAb)

Epac1/RAPGEF3 Rabbit mAb (A4149)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Epac1/RAPGEF3 Rabbit mAb (A4149) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - Epac1/RAPGEF3 Rabbit mAb (A4149)

Immunohistochemistry analysis of paraffin-embedded Human placenta using Epac1/RAPGEF3 Rabbit mAb (A4149) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Overview

Product name	Epac1/RAPGEF3 Rabbit mAb
Catalog No.	A4149
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0908

Background

Enables guanyl-nucleotide exchange factor activity and protein domain specific binding activity. Involved in several processes, including positive regulation of protein modification process

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 824-923 of human Epac1/RAPGEF3 (O95398).
Sequence	FIHEGNHTLVENLINFEKMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARISTCSEQSLSTRSPASTWAYVQQLKVIDNQRELSRLSRELEP
Gene ID
Swiss Prot
Synonyms	EPAC; Epac1/RAPGEF3
Calculated MW	104kDa
Observed MW	100kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:100 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse lung, Mouse brain, Mouse kidney, Rat brain
Cellular location	Endomembrane system.