제품 > 항체 > 다중클론항체(pAb)

FAM38A/PIEZO1 Rabbit pAb (A4340)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from MCF7 cells, using FAM38A/PIEZO1 Rabbit pAb (A4340) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.

ABclonal:Immunofluorescence - FAM38A/PIEZO1 Rabbit pAb (A4340)

Immunofluorescence analysis of NIH-3T3 cells using FAM38A/PIEZO1 Rabbit pAb (A4340) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 using FAM38A/PIEZO1 Rabbit pAb (A4340) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of MCF-7 using FAM38A/PIEZO1 Rabbit pAb (A4340) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa using FAM38A/PIEZO1 Rabbit pAb (A4340) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	FAM38A/PIEZO1 Rabbit pAb
Catalog No.	A4340
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a mechanically-activated ion channel that links mechanical forces to biological signals. The encoded protein contains 36 transmembrane domains and functions as a homotetramer. Defects in this gene have been associated with dehydrated hereditary stomatocytosis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 2230-2420 of human FAM38A/PIEZO1 (NP_001136336.2).
Sequence	PSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPM
Gene ID
Swiss Prot
Synonyms	ER; DHS; Mib; LMPH3; FAM38A; LMPHM6; FAM38A/PIEZO1
Calculated MW	287kDa
Observed MW	286kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	MCF7
Cellular location	Cell membrane, Cell projection, Endoplasmic reticulum membrane, Endoplasmic reticulum-Golgi intermediate compartment membrane, Multi-pass membrane protein, lamellipodium membrane.
Customer validation	WB(Mus musculus)