제품 > 항체 > 다중클론항체(pAb)

FCGR1B Rabbit pAb (A17483)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Immunohistochemistry analysis of paraffin-embedded human lung cancer using FCGR1B Rabbit pAb (A17483) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human mammary cancer using FCGR1B Rabbit pAb (A17483) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human placenta using FCGR1B Rabbit pAb (A17483) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	FCGR1B Rabbit pAb
Catalog No.	A17483
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Three distinct, but closely related classes of receptors that bind the Fc portion of IgG have been identified (Fcgamma RI, II and III). The FcgammaRI family consists of three closely related genes termed A, B, and C. This gene likely encodes a non-functional protein that is not detectable at the cell surface and binds ligand with low affinity.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human FCGR1B (NP_001017986.1).
Sequence	IHRGWLLLQVSSRVFMEGEPLALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAGISQYTVKGLQLPTPVWFHVL
Gene ID
Swiss Prot
Synonyms	CD34; FCG1; FcRI; CD64b; FCGR1; IGFR1; IGFRB; FCGR1B; FcgammaRIa
Calculated MW	32kDa
Observed MW	27kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse plasma
Cellular location	plasma membrane