제품 > 항체 > 다중클론항체(pAb)

FOSL1 Rabbit pAb (A5372)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from C6 cells, using FOSL1 Rabbit pAb (A5372) at 1:1000 dilution.C6 cells were treated by PMA/TPA (200 nM) at 37℃ for 15 minutes after serum-starvation overnight.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Western blot analysis of lysates from HeLa cells, using FOSL1 Rabbit pAb (A5372) at 1:1000 dilution.HeLa cells were treated by PMA/TPA (200 nM) at 37℃ for 15 minutes after serum-starvation overnight.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	FOSL1 Rabbit pAb
Catalog No.	A5372
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Several transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FOSL1 (NP_005429.1).
Sequence	MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQI
Gene ID
Swiss Prot
Synonyms	FRA; FRA1; fra-1; FOSL1
Calculated MW	29kDa
Observed MW	40kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa treated by TPA, C6 treated by TPA
Cellular location	Nucleus
Customer validation	WB(Homo sapiens, Rattus norvegicus, Mus musculus) IHC(Mus musculus) IHC(Homo sapiens)