Reviews (3)Publications (22) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat, Monkey
Product name | FOXO1 Rabbit pAb |
---|---|
Catalog No. | A2934 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 340-580 of human FOXO1 (NP_002006.2). |
---|---|
Sequence | EGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSS |
Gene ID | |
Swiss Prot | |
Synonyms | FKH1; FKHR; FOXO1A; FOXO1 |
Calculated MW | 70kDa |
Observed MW | 74kDa |
Reactivity | Human, Mouse, Rat, Monkey |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Mouse liver, Mouse brain, Rat kidney |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | (293T, SW480, HEK293T,DLD-1) WB(Homo sapiens, Mus musculus, Gallus gallus, Bos taurus, Rattus norvegicus, Mus musculus, Macaca mulatta) IF(Homo sapiens) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A2934? Please let us know so that we can cite the reference in this datasheet.