Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | FTO Rabbit pAb |
---|---|
Catalog No. | A1438 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 327-504 of human FTO (NP_001073901.1). |
---|---|
Sequence | STGTLDYILQRCQLALQNVCDDVDNDDVSLKSFEPAVLKQGEEIHNEVEFEWLRQFWFQGNRYRKCTDWWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQLLEAK |
Gene ID | |
Swiss Prot | |
Synonyms | GDFD; ALKBH9; BMIQ14; FTO |
Calculated MW | 58kDa |
Observed MW | 60kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunoprecipitation |
Positive samples | HeLa, 293T, SH-SY5Y |
Cellular location | Nucleus, Nucleus speckle |
Customer validation | WB(Homo sapiens, Rattus norvegicus, Mus musculus, Mus musculus, Sus scrofa) Co-IP(Rattus norvegicus) WB(Rattus norvegicus) IHC(Mus musculus) IF(Sus scrofa, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A1438? Please let us know so that we can cite the reference in this datasheet.