Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | FUNDC1 Rabbit mAb |
---|---|
Catalog No. | A27503 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC74039 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FUNDC1 (NP_776155.1). |
---|---|
Sequence | MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWK |
Gene ID | |
Swiss Prot | |
Synonyms | Fundc1 |
Calculated MW | 17kDa |
Observed MW | 17kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunoprecipitation |
Positive samples | T-47D, Mouse brain, Mouse heart |
Cellular location | mitochondrial outer membrane. |
* For research use only. Not for therapeutic or diagnostic purposes.