Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using Fibrillarin/U3 RNP Rabbit mAb (A0850) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of various lysates using Fibrillarin/U3 RNP Rabbit mAb (A0850) at 1:5000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Confocal imaging of U-2OS cells using Fibrillarin/U3 RNP Rabbit mAb (A0850, dilution 1:100) (Red) . The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.
Immunoprecipitation of Fibrillarin/U3 RNP Rabbit mAb from 300 µg extracts of 293F cells was performed using 3 µg of Fibrillarin/U3 RNP Rabbit mAb (A0850). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using Fibrillarin/U3 RNP Rabbit mAb (A0850) at a dilution of 1 : 2000.
| Product name | Fibrillarin/U3 RNP Rabbit mAb |
|---|---|
| Catalog No. | A0850 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC0506 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 222-321 of human Fibrillarin/U3 RNP (P22087). |
|---|---|
| Sequence | KYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN |
| Gene ID | |
| Swiss Prot | |
| Synonyms | FIB; FLRN; Nop1; RNU3IP1; Fibrillarin/U3 RNP |
| Calculated MW | 34kDa |
| Observed MW | 37kDa/37kd |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence Immunoprecipitation |
| Positive samples | 293T, Hep G2, Jurkat, Mouse spleen, Rat liver, 293F |
| Cellular location | Nucleus, nucleolus. |
| Customer validation | WB(Homo sapiens, Danio rerio) IF(Homo sapiens, Mus musculus) IP(Mus musculus) WB(Homo sapiens,Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0850? Please let us know so that we can cite the reference in this datasheet.
