Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Fibrillarin/U3 RNP Rabbit mAb |
---|---|
Catalog No. | A0850 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0506 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 222-321 of human Fibrillarin/U3 RNP (P22087). |
---|---|
Sequence | KYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN |
Gene ID | |
Swiss Prot | |
Synonyms | FIB; FLRN; Nop1; RNU3IP1; Fibrillarin/U3 RNP |
Calculated MW | 34kDa |
Observed MW | 37kDa/37kd |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence Immunoprecipitation |
Positive samples | 293T, Hep G2, Jurkat, Mouse spleen, Rat liver, 293F |
Cellular location | Nucleus, nucleolus. |
Customer validation | WB(Homo sapiens, Danio rerio) IF(Homo sapiens, Mus musculus) IP(Mus musculus) WB(Homo sapiens,Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0850? Please let us know so that we can cite the reference in this datasheet.