제품 > 항체 > 다중클론항체(pAb)

Fibrillarin/U3 RNP Rabbit pAb (A13490)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat, Monkey

Western blot analysis of various lysates using Fibrillarin/U3 RNP Rabbit pAb (A13490) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunofluorescence - Fibrillarin/U3 RNP Rabbit pAb (A13490)

Immunofluorescence analysis of HeLa cells using Fibrillarin/U3 RNP Rabbit pAb (A13490) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of C6 cells using Fibrillarin/U3 RNP Rabbit pAb (A13490) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using Fibrillarin/U3 RNP Rabbit pAb (A13490) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - Fibrillarin/U3 RNP Rabbit pAb (A13490)

Immunoprecipitation analysis of 200 μg extracts of HeLa cells using 1 μg Fibrillarin/U3 RNP antibody (A13490). Western blot was performed from the immunoprecipitate using Fibrillarin/U3 RNP antibody (A13490) at a dilution of 1:1000.

Overview

Product name	Fibrillarin/U3 RNP Rabbit pAb
Catalog No.	A13490
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene product is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. The encoded protein contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 100-321 of human Fibrillarin/U3 RNP (NP_001427.2).
Sequence	RGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN
Gene ID
Swiss Prot
Synonyms	FIB; FLRN; Nop1; RNU3IP1; Fibrillarin/U3 RNP
Calculated MW	34kDa
Observed MW	37kDa

Applications

Reactivity	Human, Mouse, Rat, Monkey
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HeLa, A375, U-2OS, COS-1, COS-7, PC-12, Mouse brain
Cellular location	Nucleus, nucleolus
Customer validation	WB(Homo sapiens) IF(Homo sapiens) IF(Drosophila melanogaster)