제품 > 항체 > 단일클론항체(mAb)

Fibroblast activation protein-α (FAP) Rabbit mAb (A23789)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using Fibroblast activation protein-α (FAP) Rabbit mAb (A23789) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - Fibroblast activation protein-α (FAP) Rabbit mAb (A23789)

Immunofluorescence analysis of NIH/3T3 cells using Fibroblast activation protein-α (FAP) Rabbit mAb (A23789) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-87MG cells using Fibroblast activation protein-α (FAP) Rabbit mAb (A23789) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Fibroblast activation protein-α (FAP) Rabbit mAb
Catalog No.	A23789
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61700

Background

The protein encoded by this gene is a homodimeric integral membrane gelatinase belonging to the serine protease family. It is selectively expressed in reactive stromal fibroblasts of epithelial cancers, granulation tissue of healing wounds, and malignant cells of bone and soft tissue sarcomas. This protein is thought to be involved in the control of fibroblast growth or epithelial-mesenchymal interactions during development, tissue repair, and epithelial carcinogenesis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 411-510 of human FAP (NP_004451.2).
Sequence	SSNEFEEYPGRRNIYRISIGSYPPSKKCVTCHLRKERCQYYTASFSDYAKYYALVCYGPGIPISTLHDGRTDQEIKILEENKELENALKNIQLPKEEIKK
Gene ID
Swiss Prot
Synonyms	FAP; DPPIV; FAPA; FAPalpha; SIMP; prolyl endopeptidase FAP; Fibroblast activation protein-α (FAP)
Calculated MW	26kDa/87kDa
Observed MW	95kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:4000 IF/ICC 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	U-87MG, Rat uterus
Cellular location	Cell membrane, Cell projection, Cell surface, Cytoplasm, Membrane, Secreted, Single-pass type II membrane protein, Single-pass type II membrane protein, invadopodium membrane, lamellipodium membrane, ruffle membrane.