Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Fibroblast activation protein-α (FAP) Rabbit mAb |
---|---|
Catalog No. | A23789 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC61700 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 411-510 of human FAP (NP_004451.2). |
---|---|
Sequence | SSNEFEEYPGRRNIYRISIGSYPPSKKCVTCHLRKERCQYYTASFSDYAKYYALVCYGPGIPISTLHDGRTDQEIKILEENKELENALKNIQLPKEEIKK |
Gene ID | |
Swiss Prot | |
Synonyms | FAP; DPPIV; FAPA; FAPalpha; SIMP; prolyl endopeptidase FAP; Fibroblast activation protein-α (FAP) |
Calculated MW | 26kDa/87kDa |
Observed MW | 95kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | U-87MG, Rat uterus |
Cellular location | Cell membrane, Cell projection, Cell surface, Cytoplasm, Membrane, Secreted, Single-pass type II membrane protein, Single-pass type II membrane protein, invadopodium membrane, lamellipodium membrane, ruffle membrane. |
Customer validation | IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A23789? Please let us know so that we can cite the reference in this datasheet.