Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Fibronectin Rabbit pAb |
---|---|
Catalog No. | A7488 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human Fibronectin (NP_002017.1). |
---|---|
Sequence | MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQINQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGA |
Gene ID | |
Swiss Prot | |
Synonyms | FN; CIG; FNZ; MSF; ED-B; FINC; GFND; LETS; GFND2; SMDCF; Fibronectin |
Calculated MW | 272kDa |
Observed MW | 290kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | NIH/3T3 |
Cellular location | Secreted, extracellular matrix, extracellular space. |
Customer validation | WB(Rattus norvegicus, Mus musculus, Homo sapiens, Rattus norvegicus ) IF(Rattus norvegicus) IHC(Homo sapiens, Rattus norvegicus ) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A7488? Please let us know so that we can cite the reference in this datasheet.