제품 > 항체 > 단일클론항체(mAb)

GABARAP Rabbit mAb (A4335)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using GABARAP Rabbit mAb (A4335) at 1:1000 dilution.293T、NIH/3T3 and C6 cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% BSA.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Review

Overview

Product name	GABARAP Rabbit mAb
Catalog No.	A4335
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1057

Background

Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. This gene encodes GABA(A) receptor-associated protein, which is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GABARAP (O95166).
Sequence	MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHE
Gene ID
Swiss Prot
Synonyms	MM46; ATG8A; GABARAP-a; GABARAP
Calculated MW	14kDa
Observed MW	16kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T treated by Chloroquine, NIH/3T3 treated by Chloroquine, C6 treated by Chloroquine
Cellular location	Cytoplasm, Cytoplasmic vesicle, Endomembrane system, Golgi apparatus membrane, autophagosome, cytoskeleton
Customer validation	(PC-3、HL-60、U2-OS、293T)