Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Rat
Western blot analysis of lysates from wild type (WT) and 293T cells transfected with KCNJ6 using GIRK2(KCNJ6) Rabbit mAb (A24391) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Confocal imaging of 293F-KCNJ6 and 293F cells using GIRK2(KCNJ6) Rabbit mAb (A24391, dilution 1:200)(Red). DAPI was used for nuclear staining (blue). Objective: 100x.
Confocal imaging of paraffin-embedded Rat brain tissue using GIRK2(KCNJ6) Rabbit mAb (A24391, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
| Product name | GIRK2(KCNJ6) Rabbit mAb |
|---|---|
| Catalog No. | A24391 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC63224 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GIRK2(NP_002231.1). |
|---|---|
| Sequence | MAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKDGKCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVY |
| Gene ID | |
| Swiss Prot | |
| Synonyms | BIR1; GIRK2; KATP2; KCNJ7; KPLBS; GIRK-2; KATP-2; KIR3.2; hiGIRK2; GIRK2(KCNJ6) |
| Calculated MW | 48kDa |
| Observed MW | 48kDa |
| Reactivity | Human, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | 293T transfected with KCNJ6 |
| Cellular location | Membrane, Multi-pass membrane protein. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
