Review (1)Publications (30) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | GLUT4 Rabbit pAb |
---|---|
Catalog No. | A7637 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 450-509 of human GLUT4 (NP_001033.1). |
---|---|
Sequence | FLLFAVLLLGFFIFTFLRVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND |
Gene ID | |
Swiss Prot | |
Synonyms | GLUT4 |
Calculated MW | 55kDa |
Observed MW | 55kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | HeLa, RD, Jurkat, NIH/3T3, H9C2 |
Cellular location | Cell membrane, Cytoplasm, Endomembrane system, Multi-pass membrane protein, perinuclear region |
Customer validation | (Mouse heart tissue) WB(Homo sapiens, Mus musculus, Mus musculus, Rattus norvegicus, Other) IHC(Mesocricetus auratus, Homo sapiens) IHC(Homo sapiens, Mus musculus) IF(Mus musculus, Rattus norvegicus) ELISA(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A7637? Please let us know so that we can cite the reference in this datasheet.