제품 > 항체 > 단일클론항체(mAb)

Grp75/MOT/HSPA9 Rabbit mAb (A11256)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Grp75/MOT/HSPA9 Rabbit mAb (A11256) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Review

Overview

Product name	Grp75/MOT/HSPA9 Rabbit mAb
Catalog No.	A11256
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0566

Background

This gene encodes a member of the heat shock protein 70 gene family. The encoded protein is primarily localized to the mitochondria but is also found in the endoplasmic reticulum, plasma membrane and cytoplasmic vesicles. This protein is a heat-shock cognate protein. This protein plays a role in cell proliferation, stress response and maintenance of the mitochondria. A pseudogene of this gene is found on chromosome 2.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 580-679 of human Grp75/MOT/HSPA9 (P38646).
Sequence	EAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ
Gene ID
Swiss Prot
Synonyms	CSA; MOT; MOT2; SAAN; CRP40; EVPLS; GRP75; PBP74; GRP-75; HSPA9B; SIDBA4; MTHSP75; HEL-S-124m; Grp75/MOT/HSPA9
Calculated MW	74kDa
Observed MW	74kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, HepG2, MCF7, Mouse liver, Mouse brain, Mouse kidney, Rat liver, Rat brain, Rat kidney
Cellular location	Mitochondrion, Nucleus, Nucleolus.
Customer validation	(HepG2 、T-47D, HepG2，T47D) WB(Gallus gallus, Homo sapiens, Mus musculus)