Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:HCoV-OC43
Product name | HCoV-OC43 Nucleoprotein Rabbit pAb |
---|---|
Catalog No. | A20610 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of coronavirus Nucleoprotein (YP_009555245.1). |
---|---|
Sequence | YWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVYWVASNQADVNTPADIVDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRS |
Gene ID | |
Swiss Prot | |
Synonyms | |
Calculated MW | 49kDa |
Observed MW | 50kDa |
Reactivity | HCoV-OC43 |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Human coronavirus (HCoV-OC43) Nucleocapsid Protein (His Tag) |
Cellular location | |
Customer validation | IHC(Mus musculus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A20610? Please let us know so that we can cite the reference in this datasheet.