Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | HDAC2 Rabbit pAb |
---|---|
Catalog No. | A2084 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 390-488 of human HDAC2 (NP_001518.3). |
---|---|
Sequence | VHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP |
Gene ID | |
Swiss Prot | |
Synonyms | HD2; RPD3; YAF1; KDAC2; HDAC2 |
Calculated MW | 55kDa |
Observed MW | 60kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunoprecipitation |
Positive samples | K-562, NIH/3T3, COS-1, COS-7, HeLa, Jurkat, SH-SY5Y |
Cellular location | Cytoplasm, Nucleus |
Customer validation | IHC(Homo sapiens) WB(Homo sapiens, Rattus norvegicus, Mus musculus ) qPCR(Rattus norvegicus) IF(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A2084? Please let us know so that we can cite the reference in this datasheet.