Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | HIF-1alpha Rabbit mAb |
---|---|
Catalog No. | A22041 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0135 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 600-700 of human HIF1α (NP_001521.1). |
---|---|
Sequence | TVFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTT |
Gene ID | |
Swiss Prot | |
Synonyms | HIF1; MOP1; PASD8; HIF-1A; bHLHe78; HIF-1alpha; HIF1-ALPHA; HIF-1-alpha |
Calculated MW | 93kDa |
Observed MW | 120kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa treated by Cobalt chloride |
Cellular location | axon cytoplasm, cytoplasm, cytosol, nuclear body, nuclear speck, nucleoplasm, nucleus. |
Customer validation | WB(Rattus norvegicus, Mus musculus, Homo sapiens, Gallus gallus) IF(Mus musculus, Homo sapiens) IHC(Homo sapiens, Mus musculus) IF(Mus musculus, Gallus gallus, Rattus norvegicus) IHC(Rattus norvegicus) WB(Homo sapiens) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22041? Please let us know so that we can cite the reference in this datasheet.