Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Immunohistochemistry analysis of paraffin-embedded Rat liver using HILPDA Rabbit pAb (A18221) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human colon using HILPDA Rabbit pAb (A18221) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
| Product name | HILPDA Rabbit pAb |
|---|---|
| Catalog No. | A18221 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human HILPDA (NP_037464.1). |
|---|---|
| Sequence | MKHVLNLYLLGVVLTLLSIFVRVMESLEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM |
| Gene ID | |
| Swiss Prot | |
| Synonyms | HIG2; HIG-2; C7orf68; HILPDA |
| Calculated MW | 7kDa |
| Observed MW | Refer to figures |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
| Key application | Immunohistochemistry |
| Positive samples | |
| Cellular location | cell surface, cytosol, extracellular space, lipid droplet, nucleoplasm |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
