제품 > 항체 > 단일클론항체(mAb)

HLA-DR Rabbit mAb (A26151)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using HLA-DR Rabbit mAb (A26151)at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): 293F
Exposure time: 45s.

ABclonal:Immunofluorescence - HLA-DR Rabbit mAb (A26151)

Confocal imaging of KARPAS-299 cells using HLA-DR Rabbit mAb (A26151, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of Daudi cells using HLA-DR Rabbit mAb (A26151, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Overview

Product name	HLA-DR Rabbit mAb
Catalog No.	A26151
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC68804

Background

HLA-DRA is one of the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha and a beta chain, both anchored in the membrane. This molecule is expressed on the surface of various antigen presenting cells such as B lymphocytes, dendritic cells, and monocytes/macrophages, and plays a central role in the immune system and response by presenting peptides derived from extracellular proteins, in particular, pathogen-derived peptides to T cells. The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. DRA does not have polymorphisms in the peptide binding part and acts as the sole alpha chain for DRB1, DRB3, DRB4 and DRB5.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 26-126 of human HLA-DRA (NP_061984.2).
Sequence	IKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELRE
Gene ID
Swiss Prot
Synonyms	HLA-DRA1
Calculated MW	29kDa
Observed MW	30-40kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3
Key application	Western blotting Immunofluorescence
Positive samples	Daudi, U-87 MG
Cellular location	Cell membrane, Endoplasmic reticulum membrane, Endosome membrane, Golgi apparatus, Late endosome membrane, Lysosome membrane, Single-pass type I membrane protein, trans-Golgi network membrane.