제품 > 항체 > 단일클론항체(mAb)

HLTF Rabbit mAb (A5068)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using HLTF Rabbit mAb (A5068) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	HLTF Rabbit mAb
Catalog No.	A5068
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1982

Background

This gene encodes a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform that is truncated at the N-terminus compared to the full-length protein.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 900-1009 of human HLTF (Q14527).
Sequence	TEAGSPTIMLLSLKAGGVGLNLSAASRVFLMDPAWNPAAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAKINEIRTLIDL
Gene ID
Swiss Prot
Synonyms	ZBU1; HLTF1; RNF80; HIP116; SNF2L3; HIP116A; SMARCA3; HLTF
Calculated MW	114kDa
Observed MW	114kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:4000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, 293T, HepG2, Mouse lung, Mouse heart, Rat lung
Cellular location	Cytoplasm, Nucleus, nucleolus, nucleoplasm.
Customer validation	WB(Homo sapiens)