제품 > 항체 > 다중클론항체(pAb)

HMGA2 Rabbit pAb (A2972)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using HMGA2 Rabbit pAb (A2972) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunohistochemistry - HMGA2 Rabbit pAb (A2972)

Immunohistochemistry analysis of paraffin-embedded Mouse embryos using HMGA2 Rabbit pAb (A2972) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	HMGA2 Rabbit pAb
Catalog No.	A2972
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a protein that belongs to the non-histone chromosomal high mobility group (HMG) protein family. HMG proteins function as architectural factors and are essential components of the enhancesome. This protein contains structural DNA-binding domains and may act as a transcriptional regulating factor. Identification of the deletion, amplification, and rearrangement of this gene that are associated with myxoid liposarcoma suggests a role in adipogenesis and mesenchymal differentiation. A gene knock out study of the mouse counterpart demonstrated that this gene is involved in diet-induced obesity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 55-109 of human HMGA2 (NP_003474.1).
Sequence	SKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED
Gene ID
Swiss Prot
Synonyms	BABL; LIPO; SRS5; HMGIC; HMGI-C; STQTL9; HMGA2
Calculated MW	12kDa
Observed MW	18kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HCT116, 293T, Mouse brain, Rat liver, Rat thymus
Cellular location	Nucleus.
Customer validation	WB(Mus musculus, Homo sapiens, Mus musculus) IHC(Homo sapiens)