Reviews (3)Publications (40) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | HMGB1 Rabbit pAb |
---|---|
Catalog No. | A2553 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 69-168 of human HMGB1 (NP_002119.1). |
---|---|
Sequence | ARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKP |
Gene ID | |
Swiss Prot | |
Synonyms | HMG1; HMG3; HMG-1; SBP-1; HMGB1 |
Calculated MW | 25kDa |
Observed MW | 29kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | 293T, Mouse brain, MCF7, Mouse lung, Rat lung |
Cellular location | Cell membrane, Chromosome, Cytoplasm, Endoplasmic reticulum-Golgi intermediate compartment, Endosome, Extracellular side, Nucleus, Peripheral membrane protein, Secreted. |
Customer validation | (Mouse brain, HeLa, Mouse spinal cord) WB(Homo sapiens, Mus musculus, Rattus norvegicus, Sus scrofa, Mus musculus, Other) IHC(Rattus norvegicus, Mus musculus) IF(Mus musculus, Homo sapiens, Other) IP(Mus musculus) IF(Homo sapiens, Mus musculus) IHC(Homo sapiens, Mus musculus, Rattus norvegicus) qPCR(Mus musculus) Co-IP(Mus musculus) ELISA(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A2553? Please let us know so that we can cite the reference in this datasheet.