Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from HeLa cells, using Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A21452) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of various lysates using Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A21452) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of lysates from HepG2 cells, using Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A21452) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of lysates from HeLa cells using Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A21452) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of various lysates using Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A21452) at 1:1000 dilution .
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90ss.
Immunofluorescence analysis of PC-12 using Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A21452) at dilution of 1 : 50 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HepG2 using Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (A21452) at dilution of 1 : 50 (40x lens). Blue: DAPI for nuclear staining.
| Product name | Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb |
|---|---|
| Catalog No. | A21452 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-288 of human Heme Oxygenase 1 (HO-1/HMOX1) (NP_002124.1). |
|---|---|
| Sequence | MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM |
| Gene ID | |
| Swiss Prot | |
| Synonyms | HO-1; HSP32; HMOX1D; bK286B10; Heme Oxygenase 1 (HO-1/HMOX1) |
| Calculated MW | 33kDa |
| Observed MW | 33kDa/ |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | HeLa, HepG2, HeLa, NIH/3T3, Rat liver |
| Cellular location | Cytoplasmic side, Endoplasmic reticulum membrane, Microsome, Peripheral membrane protein. |
| Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A21452? Please let us know so that we can cite the reference in this datasheet.
