Reviews (5)Publications (39) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates, using Hexokinase II Rabbit pAb (A0994) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human breast cancer using Hexokinase II Rabbit pAb (A0994) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon using Hexokinase II Rabbit pAb (A0994) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse heart using Hexokinase II Rabbit pAb (A0994) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat heart using Hexokinase II Rabbit pAb (A0994) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH/3T3 cells using Hexokinase II Rabbit pAb (A0994) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using Hexokinase II Rabbit pAb (A0994) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using Hexokinase II Rabbit pAb (A0994) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | Hexokinase II Rabbit pAb |
|---|---|
| Catalog No. | A0994 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Hexokinase II (NP_000180.2). |
|---|---|
| Sequence | MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMR |
| Gene ID | |
| Swiss Prot | |
| Synonyms | HKII; HXK2; Hexokinase II |
| Calculated MW | 102kDa |
| Observed MW | 102kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | RD, Mouse skeletal muscle |
| Cellular location | Mitochondrion outer membrane |
| Customer validation | (SH-SY5Y, H460, unknow, SK-N-SH, U251,U87MG) WB(Homo sapiens, Mus musculus, Rattus norvegicus, Sus scrofa, Rattus norvegicus , Gallus gallus, Mus musculus) IF(Homo sapiens) IHC(Homo sapiens, Rattus norvegicus) IHC(Homo sapiens, Mus musculus, Rattus norvegicus) IF(Gallus gallus) Other(Homo sapiens) WB(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A0994? Please let us know so that we can cite the reference in this datasheet.
![[KO Validated] Hexokinase II Rabbit mAb](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22319_ARC52057-02_WB_01.jpg?t=1721356977)
