Reviews (5)Publications (43) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Hexokinase II Rabbit pAb |
---|---|
Catalog No. | A0994 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Hexokinase II (NP_000180.2). |
---|---|
Sequence | MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMR |
Gene ID | |
Swiss Prot | |
Synonyms | HKII; HXK2; Hexokinase II |
Calculated MW | 102kDa |
Observed MW | 102kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | RD, Mouse skeletal muscle |
Cellular location | Mitochondrion outer membrane |
Customer validation | (SH-SY5Y, H460, unknow, SK-N-SH, U251,U87MG) WB(Homo sapiens, Mus musculus, Rattus norvegicus, Sus scrofa, Rattus norvegicus , Gallus gallus, Mus musculus) IF(Homo sapiens, Mus musculus) IHC(Homo sapiens, Rattus norvegicus) IHC(Homo sapiens, Mus musculus, Rattus norvegicus) IF(Gallus gallus) Other(Homo sapiens, Mus musculus) WB(Rattus norvegicus) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A0994? Please let us know so that we can cite the reference in this datasheet.