Review (1)Publications (18) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Product name | Histone H2AX Rabbit pAb |
---|---|
Catalog No. | A2082 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-143 of human Histone H2AX (NP_002096.1). |
---|---|
Sequence | MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGK |
Gene ID | |
Swiss Prot | |
Synonyms | H2A.X; H2A/X; H2AFX; Histone H2AX |
Calculated MW | 15kDa |
Observed MW | 15kDa |
Reactivity | Human, Mouse, Rat, Other (Wide Range Predicted) |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | 293T, MCF7, HL-60, Rat heart |
Cellular location | Chromosome, Nucleus. |
Customer validation | (U87MG) WB(Homo sapiens, Sus scrofa, Mus musculus , Other, Mus musculus) IF(Homo sapiens, Gallus gallus, Mus musculus) IF(Homo sapiens) IHC(Homo sapiens) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A2082? Please let us know so that we can cite the reference in this datasheet.