Reviews (2)Publications (18) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Western blot analysis of various lysates using Histone H3 Rabbit mAb (A17562) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using Histone H3 Rabbit mAb (A17562) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using Histone H3 Rabbit mAb (A17562) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using Histone H3 Rabbit mAb (A17562) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Histone H3 Rabbit mAb (A17562) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Histone H3 Rabbit mAb (A17562) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunofluorescence analysis of PC-12 cells using Histone H3 Rabbit mAb (A17562) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Confocal imaging of HeLa cells using Histone H3 Rabbit mAb (A17562, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.
Confocal imaging of NIH/3T3 cells using Histone H3 Rabbit mAb (A17562, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.
Chromatin immunoprecipitation analysis of extracts of Oryza sativa, using Histone H3 antibody (A17562) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Chromatin immunoprecipitation analysis of extracts of Hela cells, using Histone H3 Rabbit mAb antibody (A17562) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
| Product name | Histone H3 Rabbit mAb |
|---|---|
| Catalog No. | A17562 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC50522 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H3 (NP_003520.1). |
|---|---|
| Sequence | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY |
| Gene ID | |
| Swiss Prot | |
| Synonyms | H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Histone H3 |
| Calculated MW | 15kDa |
| Observed MW | 17kDa |
| Reactivity | Human, Mouse, Rat, Other (Wide Range Predicted) |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | HeLa, HepG2, Raji, NIH/3T3 , C6, Mouse liver, Rat spleen, Rat lung |
| Cellular location | Chromosome, nucleus. |
| Customer validation | (Human stem cells, tobacco flower leaves) WB(Homo sapiens, Bombyx mori Linnaeus, Rattus norvegicus, Other, Mus musculus, Danio rerio, Saccharomyces cerevisiae) IP(Mus musculus) WB(Mus musculus) Other(Other) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A17562? Please let us know so that we can cite the reference in this datasheet.
_WB_01.jpg?t=1721357921)
(Me)_WB_01.jpg?t=1721357762)
_WB_01.jpg?t=1718354328)
_WB_01.jpg?t=1721361058)
_WB_01.jpg?t=1721358100)
_WB_01.jpg?t=1721357979)
_WB_01.jpg?t=1713324721)
_WB_02.jpg?t=1715665068)
_WB_01.jpg?t=1715656137)
_WB_01.jpg?t=1715666785)
_WB_01.jpg?t=1721355725)
_WB_01.jpg?t=1721355883)
(P)_WB_01.jpg?t=1721813706)
_WB_01.jpg?t=1721361082)
_WB_01.jpg?t=1715066854)
(Me)_WB_02.jpg?t=1713324906)
_WB_01.jpg?t=1713324899)
_WB_01.jpg?t=1713322984)
_WB_01.jpg?t=1715677777)
(jia2)_WB_01.jpg?t=1718355663)
_IHC_01.jpg?t=1715132955)
(A)_WB_02.jpg?t=1721354870)
_WB_01.jpg?t=1715670501)
_WB_01.jpg?t=1721355613)
_WB_01.jpg?t=1721355870)
_WB_01.jpg?t=1721355876)
_WB_01.jpg?t=1713323210)
_WB_01.jpg?t=1715677480)
