제품 > 항체 > 단일클론항체(mAb)

IL12B Rabbit mAb (A24262)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates, using IL12B Rabbit mAb (A24262) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - IL12B Rabbit mAb (A24262)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using IL12B Rabbit mAb (A24262) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon using IL12B Rabbit mAb (A24262) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil using IL12B Rabbit mAb (A24262) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Flow CytoMetry - IL12B Rabbit mAb (A24262)

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were intracellularly-stained with IL12B Rabbit mAb (A24262, 2 μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, blue line), followed by FITC conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, left) or IL12B Rabbit mAb (A24262, 2 μg/mL, right).

Overview

Product name	IL12B Rabbit mAb
Catalog No.	A24262
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63198

Background

This gene encodes the beta subunit p40 of the Interleukin 12 (IL-12) family of cytokines. Members of the IL-12 family form heterodimers consisting of heavy and light subunits linked by disulfide bonds. The product of this gene, p40, is a subunit of interleukins IL-12 and IL-23.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 23-335 of mouse IL12B(NP_001290173.1).
Sequence	WELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
Gene ID
Swiss Prot
Synonyms	p40; Il-12b; Il12p40; Il-12p40; IL12B
Calculated MW	38kDa
Observed MW	45-51kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:8000 IHC-P 1:200 - 1:800 FC (intra) 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	293T transfected with IL12B (Mouse)
Cellular location	Secreted.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

IL12B Rabbit mAb images

Western blot - IL12B Rabbit mAb (A24262)

Immunohistochemistry - IL12B Rabbit mAb (A24262)

Flow CytoMetry - IL12B Rabbit mAb (A24262)

Flow cytometry: 1X10^6 293T (Transfection) cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, left) or IL12B Rabbit mAb (A24262, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.