Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | IL18 Rabbit pAb |
---|---|
Catalog No. | A16737 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 31-130 of human IL18 (NP_001553.1). |
---|---|
Sequence | ENLESDYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKD |
Gene ID | |
Swiss Prot | |
Synonyms | IGIF; IL-18; IL-1g; IL1F4; IL18 |
Calculated MW | 22kDa |
Observed MW | 22kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | DU145, HeLa, Raji(Negative control) |
Cellular location | Secreted. |
Customer validation | WB(Rattus norvegicus, Mus musculus, Homo sapiens, Danio rerio, Sus scrofa, Other) ELISA(Homo sapiens) IHC(Mus musculus) Other(Mus musculus) IP(Sus scrofa) WB(Sus scrofa) IF(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16737? Please let us know so that we can cite the reference in this datasheet.