제품 > 항체 > 다중클론항체(pAb)

ITPR3 Rabbit pAb (A12794)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from HeLa cells, using ITPR3 Rabbit pAb (A12794) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - ITPR3 Rabbit pAb (A12794)

Immunofluorescence analysis of NIH-3T3 cells using ITPR3 Rabbit pAb (A12794) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - ITPR3 Rabbit pAb (A12794)

Immunoprecipitation analysis of 300 μg extracts of Hela cells using 3 μg ITPR3 antibody (A12794). Western blot was performed from the immunoprecipitate using ITPR3 antibody (A12794) at a dilution of 1:1000.

Overview

Product name	ITPR3 Rabbit pAb
Catalog No.	A12794
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a receptor for inositol 1, 4, 5-trisphosphate, a second messenger that mediates the release of intracellular calcium. The receptor contains a calcium channel at the C-terminus and the ligand-binding site at the N-terminus. Knockout studies in mice suggest that type 2 and type 3 inositol 1, 4, 5-trisphosphate receptors play a key role in exocrine secretion underlying energy metabolism and growth.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1630-1870 of human ITPR3 (NP_002215.2).
Sequence	EGSEAYQRCESGGFLSKLIQHTKDLMESEEKLCIKVLRTLQQMLLKKTKYGDRGNQLRKMLLQNYLQNRKSTSRGDLPDPIGTGLDPDWSAIAATQCRLDKEGATKLVCDLITSTKNEKIFQESIGLAIHLLDGGNTEIQKSFHNLMMSDKKSERFFKVLHDRMKRAQQETKSTVAVNMNDLGSQPHEDREPVDPTTKGRVASFSIPGSSSRYSLGPSLRRGHEVSERVQSSEMGTSVLIM
Gene ID
Swiss Prot
Synonyms	IP3R; CMT1J; IP3R3; ITPR3
Calculated MW	304kDa
Observed MW	304kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HeLa
Cellular location	Endoplasmic reticulum membrane, Multi-pass membrane protein.