제품 > 항체 > 단일클론항체(mAb)

Integrin alpha 5 (ITGA5/CD49e) Rabbit mAb (A19069)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from A-549 cells, using Integrin alpha 5 (ITGA5/CD49e) Rabbit mAb (A19069) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of various lysates using Integrin alpha 5 (ITGA5/CD49e) Rabbit mAb (A19069) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - Integrin alpha 5 (ITGA5/CD49e) Rabbit mAb (A19069)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Integrin alpha 5 (ITGA5/CD49e) Rabbit mAb (A19069) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using Integrin alpha 5 (ITGA5/CD49e) Rabbit mAb (A19069) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using Integrin alpha 5 (ITGA5/CD49e) Rabbit mAb (A19069) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using Integrin alpha 5 (ITGA5/CD49e) Rabbit mAb (A19069) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Integrin alpha 5 (ITGA5/CD49e) Rabbit mAb (A19069) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using Integrin alpha 5 (ITGA5/CD49e) Rabbit mAb (A19069) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - Integrin alpha 5 (ITGA5/CD49e) Rabbit mAb (A19069)

Confocal imaging of paraffin-embedded Rat large intestine using Integrin alpha 5 (ITGA5/CD49e) Rabbit mAb (A19069, dilution 1:50) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Confocal imaging of paraffin-embedded Human placenta using Integrin alpha 5 (ITGA5/CD49e) Rabbit mAb (A19069, dilution 1:50) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

ABclonal:Flow CytoMetry - Integrin alpha 5 (ITGA5/CD49e) Rabbit mAb (A19069)

Flow cytometry:1X10^6 Daudi cells (negative control, left) and K-562 cells (right) were intracellularly-stained with Integrin alpha 5 (ITGA5/CD49e) Rabbit mAb(A19069, 5 μg/mL, green line) or Rabbit IgG isotype control (AC042, 5 μg/mL, blue line), followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb(1:600 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Daudi cells (negative control, left) and U-87MG cells (right) were intracellularly-stained with Integrin alpha 5 (ITGA5/CD49e) Rabbit mAb(A19069, 5 μg/mL, green line) or Rabbit IgG isotype control (AC042, 5 μg/mL, blue line), followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb(1:600 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).

Overview

Product name	Integrin alpha 5 (ITGA5/CD49e) Rabbit mAb
Catalog No.	A19069
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0370

Background

The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 5 subunit. This subunit associates with the beta 1 subunit to form a fibronectin receptor. This integrin may promote tumor invasion, and higher expression of this gene may be correlated with shorter survival time in lung cancer patients. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 950-1049 of human Integrin alpha 5 (ITGA5/CD49e) (P08648).
Sequence	HQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA
Gene ID
Swiss Prot
Synonyms	FNRA; CD49e; VLA-5; VLA5A; Integrin alpha 5 (ITGA5/CD49e)
Calculated MW	115kDa
Observed MW	17kDa/150kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:200 - 1:2000 IF/ICC 1:50 - 1:400 FC (intra) 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, A-549, NIH/3T3, U-937, Mouse liver, Mouse heart, Rat lung, Rat liver, Rat heart, Mouse lung, Mouse large intestine, Mouse spleen
Cellular location	Membrane, Single-pass type I membrane protein.
Customer validation	WB(Rattus norvegicus)