Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using Integrin alpha V (ITGAV/CD51) Rabbit mAb (A19071) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (A19071) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (A19071) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (A19071) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (A19071) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (A19071) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (A19071) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (A19071) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (A19071) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Flow cytometry:1X10^6 Daudi cells (negative control, left) and HUVEC cells (right) were intracellularly-stained with Integrin alpha V (ITGAV/CD51) Rabbit mAb(A19071, 2.5 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2.5 μg/mL, blue line), followed by FITC conjugated goat anti-rabbit pAb(1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 Daudi cells cells (negative control, left) and BEWO cells (right) were intracellularly-stained with Integrin alpha V (ITGAV/CD51) Rabbit mAb(A19071, 2.5 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2.5 μg/mL, blue line), followed by FITC conjugated goat anti-rabbit pAb(1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 Daudi cells (negative control, left) and U-251MG cells (right) were intracellularly-stained with Integrin alpha V (ITGAV/CD51) Rabbit mAb(A19071, 2.5 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2.5 μg/mL, blue line), followed by FITC conjugated goat anti-rabbit pAb(1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).
| Product name | Integrin alpha V (ITGAV/CD51) Rabbit mAb |
|---|---|
| Catalog No. | A19071 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC50621 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 949-1048 of human Integrin alpha V (ITGAV/CD51) (NP_002201.2). |
|---|---|
| Sequence | SLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CD51; MSK8; VNRA; VTNR; Integrin alpha V (ITGAV/CD51) |
| Calculated MW | 116kDa |
| Observed MW | 140kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | A549, MCF7, NIH/3T3, C6, Mouse brain, Mouse kidney, Rat kidney, Rat lung |
| Cellular location | Membrane, Single-pass type I membrane protein. |
| Customer validation | IHC(Rattus norvegicus) WB(Mus musculus, Homo sapiens, Sus scrofa) IHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19071? Please let us know so that we can cite the reference in this datasheet.
Y_FC_01.jpg?t=1717034591)
i_FC_01.jpg?t=1717034634)
