제품 > 항체 > 단일클론항체(mAb)

Integrin beta 3 (ITGB3/CD61) Rabbit mAb (A19073)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

ABclonal:Western blot - Integrin beta 3 (ITGB3/CD61) Rabbit mAb (A19073)

Western blot analysis of various lysates using Integrin beta 3 (ITGB3/CD61) Rabbit mAb (A19073) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Integrin beta 3 (ITGB3/CD61) Rabbit mAb (A19073)

Immunohistochemistry analysis of paraffin-embedded Rat bone marrow using Integrin beta 3 (ITGB3/CD61) Rabbit mAb (A19073) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse bone marrow using Integrin beta 3 (ITGB3/CD61) Rabbit mAb (A19073) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

ABclonal:Immunoprecipitation - Integrin beta 3 (ITGB3/CD61) Rabbit mAb (A19073)

Immunoprecipitation analysis of 300 μg extracts of U-87MG cells using 3 μg Integrin beta 3 (ITGB3/CD61) antibody (A19073). Western blot was performed from the immunoprecipitate using Integrin beta 3 (ITGB3/CD61) antibody (A19073) at a dilution of 1:1000.

ABclonal:Flow CytoMetry - Integrin beta 3 (ITGB3/CD61) Rabbit mAb (A19073)

Flow cytometry:1X10^6 U-937 cells (negative control, left) and HEL cells (right) were intracellularly-stained with Integrin beta 3 (ITGB3/CD61) Rabbit mAb(A19073, 2.5 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2.5 μg/mL, blue line), followed by FITC conjugated goat anti-rabbit pAb(1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).

Overview

Product name	Integrin beta 3 (ITGB3/CD61) Rabbit mAb
Catalog No.	A19073
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0460

Background

The ITGB3 protein product is the integrin beta chain beta 3. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. Integrin beta 3 is found along with the alpha IIb chain in platelets. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 689-788 of human Integrin beta 3 (ITGB3/CD61) (P05106).
Sequence	CVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT
Gene ID
Swiss Prot
Synonyms	GT; GT2; CD61; GP3A; BDPLT2; GPIIIa; BDPLT16; BDPLT24; Integrin beta 3 (ITGB3/CD61)
Calculated MW	87kDa
Observed MW	110kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:100 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells FC (intra) 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	U-87MG, HUVEC, Mouse lung
Cellular location	Cell junction, Cell membrane, Cell projection, Single-pass type I membrane protein, focal adhesion, lamellipodium membrane.
Customer validation	IF(Rattus norvegicus) WB(Homo sapiens, Mus musculus) IP(Homo sapiens)