Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | JAK2 Rabbit mAb |
---|---|
Catalog No. | A19629 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0108 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1033-1132 of human JAK2 (O60674). |
---|---|
Sequence | VASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG |
Gene ID | |
Swiss Prot | |
Synonyms | JTK10; JAK2 |
Calculated MW | 131kDa |
Observed MW | 130kDa/ |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse lung, Mouse brain |
Cellular location | Cytoplasm, Endomembrane system, Nucleus, Peripheral membrane protein. |
Customer validation | WB(Homo sapiens, Mus musculus, Rattus norvegicus, Mus musculus) IF(Mus musculus) IHC(Mus musculus) RIP(Homo sapiens) IF(Homo sapiens) IP(Homo sapiens) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19629? Please let us know so that we can cite the reference in this datasheet.