Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | K48-linkage Specific Ubiquitin Rabbit mAb |
---|---|
Catalog No. | A3606 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0811 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ubiquitin (P0CG47). |
---|---|
Sequence | MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE |
Gene ID | |
Swiss Prot | |
Synonyms | HEL-S-50; K48-linkage Specific Ubiquitin |
Calculated MW | 26kDa |
Observed MW | 17-250kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | HeLa treated by MG132 |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | WB(Homo sapiens, Mus musculus) IF(Homo sapiens) Other(Oryza sativa) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3606? Please let us know so that we can cite the reference in this datasheet.